ProPAS example 1:

Input sequences (Fasta format):

>IPI00177321 Tax_Id=9606 similar to NOD3 protein
MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQ
LNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNL
DYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENYPTALRSLVLAEN
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPAAHQRGSSSWMCPSDPSSQMV
LMTSGLGDSLLAETEM
>IPI00043226 Tax_Id=9606 hypothetical protein XP_071712
MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYA
PENYNSPASLDTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAA
EYFYPSTDCVDFAPSAAATSDFYKRETNCDICYS
>IPI00015171 Tax_Id=9606 AFG3-like protein 1
VVVLAGTNRPDVLDPALMRPGRFHRQIYTGPPYIKGRSSIFKVHLRPLKLDKSLNKDTLA
RKLAVLTPG
>IPI00288891 Tax_Id=9606 Splice isoform 1 of Q9NR11 Zinc finger protein 302
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGK
EPWMMEKKLSKAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNS
PNSTVEAFSRSKKKKKKKKKRQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEK
VVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSV
IKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIYTCSECGKAFGKQSILSRHWR
IHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSSLTNHQSTHTG
EKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPY
ECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV

Change the steps for following parameters:
  pI: 0.5
  MW: 10000
  Hy: 0.1

Results:

======Result of the physicochemical property for each protein======  List the values of pI, Hy and MW for each protein

Pro_id Hydrophobicity MW pI
IPI00177321 0.0209 33409.048 4.72
IPI00043226 -0.4389 16850.253 4.27
IPI00015171 -0.2231 7704.16 11.03
IPI00288891 -0.6323 54813.561 9.13


==========Result of the pI stat==========  Distribution of pI values

0-0.5 0 0
0.5-1 0 0
1-1.5 0 0
1.5-2 0 0
2-2.5 0 0
2.5-3 0 0
3-3.5 0 0
3.5-4 0 0
4-4.5 1 0.25
4.5-5 1 0.25
5-5.5 0 0
5.5-6 0 0
6-6.5 0 0
6.5-7 0 0
7-7.5 0 0
7.5-8 0 0
8-8.5 0 0
8.5-9 0 0
9-9.5 1 0.25
9.5-10 0 0
10-10.5 0 0
10.5-11 0 0
11-11.5 1 0.25
11.5-12 0 0
12-12.5 0 0
12.5-13 0 0
13-13.5 0 0
13.5-14 0 0


==========Result of the MW stat==========  Distribution of MW values

0-10000 1 0.25
10000-20000 1 0.25
20000-30000 0 0
30000-40000 1 0.25
40000-50000 0 0
50000-60000 1 0.25
60000-70000 0 0
70000-80000 0 0
80000-90000 0 0
90000-100000 0 0
>100000 0 0

==========Result of the Hy stat==========  Distribution of Hy values

<-2 0 0
-1.99~-1.89 0 0
-1.89~-1.79 0 0
-1.79~-1.69 0 0
-1.69~-1.59 0 0
-1.59~-1.49 0 0
-1.49~-1.39 0 0
-1.39~-1.29 0 0
-1.29~-1.19 0 0
-1.19~-1.09 0 0
-1.09~-0.99 0 0
-0.99~-0.89 0 0
-0.89~-0.79 0 0
-0.79~-0.69 0 0
-0.69~-0.59 1 0.25
-0.59~-0.49 0 0
-0.49~-0.39 1 0.25
-0.39~-0.29 0 0
-0.29~-0.19 1 0.25
-0.19~-0.09 0 0
-0.09~0 0 0
0~0.1 1 0.25
0.1~0.2 0 0
0.2~0.3 0 0
0.3~0.4 0 0
0.4~0.5 0 0
0.5~0.6 0 0
0.6~0.7 0 0
0.7~0.8 0 0
0.8~0.9 0 0
0.9~1 0 0
>1 0


==========Result of the amino acid composition stat==========  Number and percent for each amino acid

A 15 0.0147
B 0 0
C 22 0.0216
D 9 0.0088
E 39 0.0383
F 27 0.0265
G 24 0.0236
H 25 0.0246
I 22 0.0216
J 0 0
K 53 0.0521
L 34 0.0334
M 9 0.0088
N 21 0.0206
O 0 0
P 15 0.0147
Q 20 0.0197
R 17 0.0167
S 61 0.06
T 22 0.0216
U 0 0
V 22 0.0216
W 4 0.0039
X 0 0
Y 17 0.0167
Z 0 0
Total sum = 1017