ProPAS example 2:

Input sequences (Single plain sequence format):

MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQ
LNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNL
DYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENYPTALRSLVLAEN
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPAAHQRGSSSWMCPSDPSSQMV
LMTSGLGDSLLAETEM

Change the steps for following parameters:
  pI: 0.5
  MW: 10000
  Hy: 0.1

Results:

======Result of the physicochemical property for each protein======   List the values of pI, Hy and MW for the protein

Pro_id Hydrophobicity MW pI
Single_seq 0.0209 33409.048 4.72


==========Result of the pI stat==========  Distribution of pI values

0-0.5 0 0
0.5-1 0 0
1-1.5 0 0
1.5-2 0 0
2-2.5 0 0
2.5-3 0 0
3-3.5 0 0
3.5-4 0 0
4-4.5 0 0
4.5-5 1 1
5-5.5 0 0
5.5-6 0 0
6-6.5 0 0
6.5-7 0 0
7-7.5 0 0
7.5-8 0 0
8-8.5 0 0
8.5-9 0 0
9-9.5 0 0
9.5-10 0 0
10-10.5 0 0
10.5-11 0 0
11-11.5 0 0
11.5-12 0 0
12-12.5 0 0
12.5-13 0 0
13-13.5 0 0
13.5-14 0 0


==========Result of the MW stat==========  Distribution of MW values

0-10000 0 0
10000-20000 0 0
20000-30000 0 0
30000-40000 1 1
40000-50000 0 0
50000-60000 0 0
60000-70000 0 0
70000-80000 0 0
80000-90000 0 0
90000-100000 0 0
>100000 0 0


==========Result of the Hy stat==========  Distribution of Hy values

<-2 0 0
-1.99~-1.89 0 0
-1.89~-1.79 0 0
-1.79~-1.69 0 0
-1.69~-1.59 0 0
-1.59~-1.49 0 0
-1.49~-1.39 0 0
-1.39~-1.29 0 0
-1.29~-1.19 0 0
-1.19~-1.09 0 0
-1.09~-0.99 0 0
-0.99~-0.89 0 0
-0.89~-0.79 0 0
-0.79~-0.69 0 0
-0.69~-0.59 0 0
-0.59~-0.49 0 0
-0.49~-0.39 0 0
-0.39~-0.29 0 0
-0.29~-0.19 0 0
-0.19~-0.09 0 0
-0.09~0 0 0
0~0.1 1 1
0.1~0.2 0 0
0.2~0.3 0 0
0.3~0.4 0 0
0.4~0.5 0 0
0.5~0.6 0 0
0.6~0.7 0 0
0.7~0.8 0 0
0.8~0.9 0 0
0.9~1 0 0

>1 0

==========Result of the amino acid composition stat========== 
Number and percent for each amino acid

A 32 0.1013
B 0 0
C 8 0.0253
D 17 0.0538
E 21 0.0665
F 2 0.0063
G 28 0.0886
H 5 0.0158
I 12 0.038
J 0 0
K 4 0.0127
L 53 0.1677
M 8 0.0253
N 12 0.038
O 0 0
P 16 0.0506
Q 13 0.0411
R 19 0.0601
S 32 0.1013
T 13 0.0411
U 0 0
V 16 0.0506
W 3 0.0095
X 0 0
Y 2 0.0063
Z 0 0
Total sum = 316

กก