ProPAS example 3:

Input sequences (Peptide list format):

MLPSSIQISGEPLSGAEVR
DICRGLR
DNAVRLLSLR
GCRLCDR
DFGRICR
ALAGATSLAQ
LNLNLGVVSSPSR
IKQLAEALR
TNR
SIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSR
LAIAVAHSSQVR
VLNL
DYNPLGDHVAGMLAVAVASSR
TLEVLDLEGTGLTNQSAQTLLDMVENYPTALR
SLVLAEN
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWER
GREPAAHQR
GSSSWMCPSDPSSQMV
LMTSGLGDSLLAETEM

กก

Change the steps for following parameters:
  pI: 0.5
  MW: 10000
  Hy: 0.1

Results:

======Result of the physicochemical property for each protein======    List the values of pI, Hy and MW for each peptide

Pro_id Hydrophobicity MW pI
MLPSSIQISGEPLSGAEVR 0.1211 1971.256 4.52
DICRGLR -0.2999 831.988 8.24
DNAVRLLSLR 0.06 1156.35 9.59
GCRLCDR -0.5856 821.968 8.07
DFGRICR -0.4428 866.005 8.24
ALAGATSLAQ 0.94 902.015 5.57
LNLNLGVVSSPSR 0.3 1355.557 9.75
IKQLAEALR 0.0333 1041.259 8.74
TNR -2.8999 389.412 9.41
SIQSLFLHGSPLTDAGLALLNPALALHPALVALDL 1 3563.198 5.03
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSR -0.0499 4510.218 4.86
LAIAVAHSSQVR 0.775 1251.451 9.75
VLNL 2.075 457.57 5.49
DYNPLGDHVAGMLAVAVASSR 0.2762 2143.402 5.21
TLEVLDLEGTGLTNQSAQTLLDMVENYPTALR -0.1093 3506.927 3.83
SLVLAEN 0.8286 744.843 3.99
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWER -0.957 3863.045 3.55
GREPAAHQR -1.9555 1021.104 9.6
GSSSWMCPSDPSSQMV -0.3624 1685.859 3.79
LMTSGLGDSLLAETEM 0.4063 1667.907 3.57

==========Result of the pI stat==========
  Distribution of pI values

0-0.5 0 0
0.5-1 0 0
1-1.5 0 0
1.5-2 0 0
2-2.5 0 0
2.5-3 0 0
3-3.5 0 0
3.5-4 5 0.25
4-4.5 0 0
4.5-5 2 0.1
5-5.5 3 0.15
5.5-6 1 0.05
6-6.5 0 0
6.5-7 0 0
7-7.5 0 0
7.5-8 0 0
8-8.5 3 0.15
8.5-9 1 0.05
9-9.5 1 0.05
9.5-10 4 0.2
10-10.5 0 0
10.5-11 0 0
11-11.5 0 0
11.5-12 0 0
12-12.5 0 0
12.5-13 0 0
13-13.5 0 0
13.5-14 0 0

==========Result of the MW stat========== 
Distribution of MW values

0-10000 20 1
10000-20000 0 0
20000-30000 0 0
30000-40000 0 0
40000-50000 0 0
50000-60000 0 0
60000-70000 0 0
70000-80000 0 0
80000-90000 0 0
90000-100000 0 0
>100000 0 0

==========Result of the Hy stat========== 
Distribution of Hy values

<-2 1 0.05
-1.99~-1.89 1 0.05
-1.89~-1.79 0 0
-1.79~-1.69 0 0
-1.69~-1.59 0 0
-1.59~-1.49 0 0
-1.49~-1.39 0 0
-1.39~-1.29 0 0
-1.29~-1.19 0 0
-1.19~-1.09 0 0
-1.09~-0.99 0 0
-0.99~-0.89 1 0.05
-0.89~-0.79 0 0
-0.79~-0.69 0 0
-0.69~-0.59 0 0
-0.59~-0.49 1 0.05
-0.49~-0.39 1 0.05
-0.39~-0.29 1 0.05
-0.29~-0.19 1 0.05
-0.19~-0.09 1 0.05
-0.09~0 1 0.05
0~0.1 2 0.1
0.1~0.2 1 0.05
0.2~0.3 2 0.1
0.3~0.4 0 0
0.4~0.5 1 0.05
0.5~0.6 0 0
0.6~0.7 0 0
0.7~0.8 1 0.05
0.8~0.9 1 0.05
0.9~1 1 0.05
>1 2 0.1

==========Result of the amino acid composition stat========== 
Number and percent for each amino acid

A 1 0.0032
B 0 0
C 0 0
D 1 0.0032
E 2 0.0063
F 0 0
G 2 0.0063
H 0 0
I 0 0
J 0 0
K 0 0
L 4 0.0127
M 2 0.0063
N 0 0
O 0 0
P 0 0
Q 0 0
R 0 0
S 2 0.0063
T 2 0.0063
U 0 0
V 0 0
W 0 0
X 0 0
Y 0 0
Z 0 0
Total sum = 316


กก